PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024858-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family G2-like
Protein Properties Length: 375aa    MW: 40461.8 Da    PI: 8.1625
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024858-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.5e-31209264156
                G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                            k+r++W++eLH++F++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  SMil_00024858-RA_Salv 209 KARRCWSTELHRKFLQALQQLGGSHLATPKQIRELMKVDGLTNDEVKSHLQKYRLH 264
                            68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-27206267IPR009057Homeodomain-like
PROSITE profilePS5129414.028206266IPR017930Myb domain
SuperFamilySSF466898.76E-18207266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26209264IPR006447Myb domain, plants
PfamPF002491.7E-7211262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MTINTHNHNH TDHNSPEKMQ GCQDRIHALE EERRKIQVFS RELPLCLDLV TQAIEACKQQ  60
LSGTTTEYNL NGQSECSEQT SSDAPVLEEF IPLKRASYGE EQESKKPEHD STINIAKNCQ  120
KSDWLRSVQL WNQTPDLPSN VDSPKKVGVS EVNRNGSGGA FHPFKKEKSQ VGSGAVVVAP  180
APVNRSVPPA STSSSAETGD KKEGQSQRKA RRCWSTELHR KFLQALQQLG GSHLATPKQI  240
RELMKVDGLT NDEVKSHLQK YRLHSRRPSP SIQNNNSSQA PQFVVVGGIW VPPEYAAMAA  300
TATSGSGEAS GAATSNGIYA PVATLPMPFR EASASTKKRP LPSSDDGGSL SEGGGGSHSP  360
ATSSSTHTTT ASPAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.11e-177PREDICTED: uncharacterized protein LOC105156412
TrEMBLA0A068TX101e-146A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-82G2-like family protein